Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 54187..54712 Replicon plasmid unnamed3
Accession NZ_CP097666
Organism Klebsiella pneumoniae strain IR1230_1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag M3X90_RS27670 Protein ID WP_013023785.1
Coordinates 54187..54492 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag M3X90_RS27675 Protein ID WP_001568025.1
Coordinates 54494..54712 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X90_RS27640 (49874) 49874..50500 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
M3X90_RS27645 (50497) 50497..50799 + 303 WP_004197636.1 hypothetical protein -
M3X90_RS27650 (51263) 51263..52057 - 795 WP_004197635.1 site-specific integrase -
M3X90_RS27655 (52255) 52255..53271 - 1017 WP_017899884.1 hypothetical protein -
M3X90_RS27660 (53282) 53282..53596 - 315 WP_053389906.1 hypothetical protein -
M3X90_RS27665 (53623) 53623..54018 - 396 WP_017899885.1 hypothetical protein -
M3X90_RS27670 (54187) 54187..54492 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
M3X90_RS27675 (54494) 54494..54712 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M3X90_RS27680 (54882) 54882..55343 - 462 WP_160866775.1 hypothetical protein -
M3X90_RS27685 (55300) 55300..55530 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
M3X90_RS27690 (55527) 55527..55943 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
M3X90_RS27695 (56017) 56017..57579 + 1563 WP_004206609.1 AAA family ATPase -
M3X90_RS27700 (57564) 57564..58586 + 1023 WP_000361404.1 helicase UvrD -
M3X90_RS27705 (58842) 58842..59539 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 / mph(A) / sul1 / dfrA25 / blaKPC-2 / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id - 1..147295 147295


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T245826 WP_013023785.1 NZ_CP097666:c54492-54187 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT245826 WP_001568025.1 NZ_CP097666:c54712-54494 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References