Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 27337..27862 | Replicon | plasmid unnamed3 |
Accession | NZ_CP097666 | ||
Organism | Klebsiella pneumoniae strain IR1230_1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | M3X90_RS27490 | Protein ID | WP_001159868.1 |
Coordinates | 27557..27862 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | M3X90_RS27485 | Protein ID | WP_000813634.1 |
Coordinates | 27337..27555 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X90_RS27460 (23399) | 23399..24532 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
M3X90_RS27465 (24552) | 24552..24836 | + | 285 | WP_000642771.1 | hypothetical protein | - |
M3X90_RS27470 (25007) | 25007..25654 | - | 648 | WP_000074712.1 | hypothetical protein | - |
M3X90_RS27475 (25642) | 25642..25977 | - | 336 | WP_000628093.1 | hypothetical protein | - |
M3X90_RS27480 (26157) | 26157..26738 | - | 582 | WP_000139427.1 | hypothetical protein | - |
M3X90_RS27485 (27337) | 27337..27555 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M3X90_RS27490 (27557) | 27557..27862 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M3X90_RS27495 (27863) | 27863..28669 | + | 807 | WP_249246927.1 | site-specific integrase | - |
M3X90_RS27500 (28727) | 28727..28984 | - | 258 | WP_000764642.1 | hypothetical protein | - |
M3X90_RS27505 (29113) | 29113..29217 | - | 105 | WP_032409716.1 | hypothetical protein | - |
M3X90_RS27510 (29447) | 29447..29635 | + | 189 | WP_000957857.1 | hypothetical protein | - |
M3X90_RS27515 (29645) | 29645..30844 | + | 1200 | WP_064765287.1 | IS91 family transposase | - |
M3X90_RS27520 (31014) | 31014..31850 | - | 837 | Protein_41 | ParB/RepB/Spo0J family partition protein | - |
M3X90_RS27525 (31920) | 31920..32168 | - | 249 | WP_001568055.1 | DUF905 domain-containing protein | - |
M3X90_RS27530 (32217) | 32217..32759 | - | 543 | WP_014343512.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-55 / mph(A) / sul1 / dfrA25 / blaKPC-2 / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..147295 | 147295 | |
- | flank | IS/Tn | - | - | 22206..22910 | 704 | |
- | flank | IS/Tn | - | - | 29645..30844 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T245825 WP_001159868.1 NZ_CP097666:27557-27862 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|