Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 20517..21160 Replicon plasmid unnamed2
Accession NZ_CP097665
Organism Klebsiella pneumoniae strain IR1230_1

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag M3X90_RS26595 Protein ID WP_114473036.1
Coordinates 20517..20933 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag M3X90_RS26600 Protein ID WP_001261276.1
Coordinates 20930..21160 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X90_RS26580 (M3X90_26580) 15562..17670 - 2109 WP_114473038.1 peptidase domain-containing ABC transporter -
M3X90_RS26585 (M3X90_26585) 17660..18937 - 1278 WP_114473037.1 HlyD family secretion protein -
M3X90_RS26590 (M3X90_26590) 19598..20476 + 879 WP_064182004.1 restriction endonuclease -
M3X90_RS26595 (M3X90_26595) 20517..20933 - 417 WP_114473036.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X90_RS26600 (M3X90_26600) 20930..21160 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X90_RS26605 (M3X90_26605) 21213..21587 + 375 WP_114473035.1 hypothetical protein -
M3X90_RS26610 (M3X90_26610) 21748..22692 + 945 WP_064182279.1 hypothetical protein -
M3X90_RS26615 (M3X90_26615) 22729..23130 + 402 WP_074194759.1 hypothetical protein -
M3X90_RS26620 (M3X90_26620) 23157..23480 + 324 WP_070552900.1 hypothetical protein -
M3X90_RS26625 (M3X90_26625) 23477..24493 + 1017 WP_114473034.1 hypothetical protein -
M3X90_RS26630 (M3X90_26630) 24691..25470 + 780 WP_064182282.1 site-specific integrase -
M3X90_RS26635 (M3X90_26635) 25528..25785 - 258 WP_114473033.1 hypothetical protein -
M3X90_RS26640 (M3X90_26640) 25914..26027 - 114 WP_014343462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..146332 146332


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15120.58 Da        Isoelectric Point: 8.5464

>T245823 WP_114473036.1 NZ_CP097665:c20933-20517 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILHWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT245823 WP_001261276.1 NZ_CP097665:c21160-20930 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References