Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 903..1639 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097665 | ||
| Organism | Klebsiella pneumoniae strain IR1230_1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M3X90_RS26470 | Protein ID | WP_114473045.1 |
| Coordinates | 903..1385 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | M3X90_RS26475 | Protein ID | WP_003026799.1 |
| Coordinates | 1373..1639 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X90_RS26470 (M3X90_26470) | 903..1385 | - | 483 | WP_114473045.1 | GNAT family N-acetyltransferase | Toxin |
| M3X90_RS26475 (M3X90_26475) | 1373..1639 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| M3X90_RS26480 (M3X90_26480) | 1767..2165 | + | 399 | WP_250203212.1 | hypothetical protein | - |
| M3X90_RS26485 (M3X90_26485) | 2961..3248 | + | 288 | WP_114473050.1 | chorismate mutase | - |
| M3X90_RS26490 (M3X90_26490) | 3205..3297 | - | 93 | Protein_5 | hypothetical protein | - |
| M3X90_RS26495 (M3X90_26495) | 3255..3357 | - | 103 | Protein_6 | Hok/Gef family protein | - |
| M3X90_RS26500 (M3X90_26500) | 3408..4440 | - | 1033 | Protein_7 | GlxA family transcriptional regulator | - |
| M3X90_RS26505 (M3X90_26505) | 4682..6133 | + | 1452 | WP_114473044.1 | L-tyrosine/L-tryptophan isonitrile synthase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..146332 | 146332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17298.01 Da Isoelectric Point: 9.5893
>T245822 WP_114473045.1 NZ_CP097665:c1385-903 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFKASQTHKRTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFKASQTHKRTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|