Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4079244..4079863 Replicon chromosome
Accession NZ_CP097663
Organism Klebsiella pneumoniae strain IR1230_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X90_RS20285 Protein ID WP_002892050.1
Coordinates 4079645..4079863 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X90_RS20280 Protein ID WP_002892066.1
Coordinates 4079244..4079618 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X90_RS20270 (M3X90_20270) 4074396..4075589 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X90_RS20275 (M3X90_20275) 4075612..4078758 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3X90_RS20280 (M3X90_20280) 4079244..4079618 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X90_RS20285 (M3X90_20285) 4079645..4079863 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X90_RS20290 (M3X90_20290) 4080022..4080588 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X90_RS20295 (M3X90_20295) 4080560..4080700 - 141 WP_004147370.1 hypothetical protein -
M3X90_RS20300 (M3X90_20300) 4080721..4081191 + 471 WP_002892026.1 YlaC family protein -
M3X90_RS20305 (M3X90_20305) 4081166..4082617 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X90_RS20310 (M3X90_20310) 4082718..4083416 + 699 WP_002892021.1 GNAT family protein -
M3X90_RS20315 (M3X90_20315) 4083413..4083553 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X90_RS20320 (M3X90_20320) 4083553..4083816 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245818 WP_002892050.1 NZ_CP097663:4079645-4079863 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245818 WP_002892066.1 NZ_CP097663:4079244-4079618 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References