Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 740814..741589 | Replicon | chromosome |
Accession | NZ_CP097663 | ||
Organism | Klebsiella pneumoniae strain IR1230_1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | M3X90_RS03710 | Protein ID | WP_004150910.1 |
Coordinates | 741104..741589 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | M3X90_RS03705 | Protein ID | WP_004150912.1 |
Coordinates | 740814..741107 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X90_RS03685 (M3X90_03685) | 736022..736624 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
M3X90_RS03690 (M3X90_03690) | 736722..737633 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
M3X90_RS03695 (M3X90_03695) | 737634..738782 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
M3X90_RS03700 (M3X90_03700) | 738793..740169 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
M3X90_RS03705 (M3X90_03705) | 740814..741107 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
M3X90_RS03710 (M3X90_03710) | 741104..741589 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
M3X90_RS03715 (M3X90_03715) | 742293..742886 | + | 594 | WP_004188553.1 | hypothetical protein | - |
M3X90_RS03720 (M3X90_03720) | 742983..743199 | + | 217 | Protein_731 | transposase | - |
M3X90_RS03730 (M3X90_03730) | 745111..745983 | + | 873 | WP_004188557.1 | ParA family protein | - |
M3X90_RS03735 (M3X90_03735) | 745983..746366 | + | 384 | WP_004150906.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T245811 WP_004150910.1 NZ_CP097663:741104-741589 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |