Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 6198..6723 Replicon plasmid unnamed2
Accession NZ_CP097662
Organism Klebsiella pneumoniae strain IR12243_1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag M3X86_RS27245 Protein ID WP_013023785.1
Coordinates 6418..6723 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag M3X86_RS27240 Protein ID WP_001568025.1
Coordinates 6198..6416 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X86_RS27200 (1582) 1582..1907 + 326 Protein_4 class II aldolase/adducin family protein -
M3X86_RS27205 (1961) 1961..2665 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
M3X86_RS27210 (2731) 2731..3015 + 285 Protein_6 PAS domain-containing protein -
M3X86_RS27215 (3079) 3079..3783 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
M3X86_RS27220 (3835) 3835..4893 - 1059 Protein_8 AAA family ATPase -
M3X86_RS27225 (4967) 4967..5383 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
M3X86_RS27230 (5380) 5380..5610 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
M3X86_RS27235 (5567) 5567..6028 + 462 WP_160866775.1 hypothetical protein -
M3X86_RS27240 (6198) 6198..6416 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M3X86_RS27245 (6418) 6418..6723 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
M3X86_RS27250 (6892) 6892..7287 + 396 WP_017899885.1 hypothetical protein -
M3X86_RS27255 (7314) 7314..7628 + 315 WP_053389906.1 hypothetical protein -
M3X86_RS27260 (7639) 7639..8655 + 1017 WP_017899884.1 hypothetical protein -
M3X86_RS27265 (8853) 8853..9647 + 795 WP_004197635.1 site-specific integrase -
M3X86_RS27270 (10119) 10119..10421 - 303 WP_004197636.1 hypothetical protein -
M3X86_RS27275 (10418) 10418..11044 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / fosA3 / blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 - 1..147322 147322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T245801 WP_013023785.1 NZ_CP097662:6418-6723 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT245801 WP_001568025.1 NZ_CP097662:6198-6416 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References