Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 4967..5610 Replicon plasmid unnamed2
Accession NZ_CP097662
Organism Klebsiella pneumoniae strain IR12243_1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M3X86_RS27225 Protein ID WP_001044770.1
Coordinates 4967..5383 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M3X86_RS27230 Protein ID WP_001261282.1
Coordinates 5380..5610 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X86_RS28295 (338) 338..390 + 53 Protein_1 hypothetical protein -
M3X86_RS27190 (510) 510..971 + 462 WP_142273431.1 four-carbon acid sugar kinase family protein -
M3X86_RS27195 (1111) 1111..1589 + 479 Protein_3 nucleotide-binding domain containing protein -
M3X86_RS27200 (1582) 1582..1907 + 326 Protein_4 class II aldolase/adducin family protein -
M3X86_RS27205 (1961) 1961..2665 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
M3X86_RS27210 (2731) 2731..3015 + 285 Protein_6 PAS domain-containing protein -
M3X86_RS27215 (3079) 3079..3783 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
M3X86_RS27220 (3835) 3835..4893 - 1059 Protein_8 AAA family ATPase -
M3X86_RS27225 (4967) 4967..5383 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X86_RS27230 (5380) 5380..5610 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X86_RS27235 (5567) 5567..6028 + 462 WP_160866775.1 hypothetical protein -
M3X86_RS27240 (6198) 6198..6416 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
M3X86_RS27245 (6418) 6418..6723 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
M3X86_RS27250 (6892) 6892..7287 + 396 WP_017899885.1 hypothetical protein -
M3X86_RS27255 (7314) 7314..7628 + 315 WP_053389906.1 hypothetical protein -
M3X86_RS27260 (7639) 7639..8655 + 1017 WP_017899884.1 hypothetical protein -
M3X86_RS27265 (8853) 8853..9647 + 795 WP_004197635.1 site-specific integrase -
M3X86_RS27270 (10119) 10119..10421 - 303 WP_004197636.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / fosA3 / blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 - 1..147322 147322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T245800 WP_001044770.1 NZ_CP097662:c5383-4967 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT245800 WP_001261282.1 NZ_CP097662:c5610-5380 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References