Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4208054..4208673 Replicon chromosome
Accession NZ_CP097660
Organism Klebsiella pneumoniae strain IR12243_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X86_RS21005 Protein ID WP_002892050.1
Coordinates 4208455..4208673 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X86_RS21000 Protein ID WP_002892066.1
Coordinates 4208054..4208428 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X86_RS20990 (M3X86_20990) 4203206..4204399 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X86_RS20995 (M3X86_20995) 4204422..4207568 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3X86_RS21000 (M3X86_21000) 4208054..4208428 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X86_RS21005 (M3X86_21005) 4208455..4208673 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X86_RS21010 (M3X86_21010) 4208832..4209398 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X86_RS21015 (M3X86_21015) 4209370..4209510 - 141 WP_004147370.1 hypothetical protein -
M3X86_RS21020 (M3X86_21020) 4209531..4210001 + 471 WP_002892026.1 YlaC family protein -
M3X86_RS21025 (M3X86_21025) 4209976..4211427 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X86_RS21030 (M3X86_21030) 4211528..4212226 + 699 WP_002892021.1 GNAT family protein -
M3X86_RS21035 (M3X86_21035) 4212223..4212363 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X86_RS21040 (M3X86_21040) 4212363..4212626 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245795 WP_002892050.1 NZ_CP097660:4208455-4208673 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245795 WP_002892066.1 NZ_CP097660:4208054-4208428 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References