Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 84407..85050 Replicon plasmid unnamed1
Accession NZ_CP097659
Organism Klebsiella pneumoniae strain IR12099_1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M3X93_RS27265 Protein ID WP_001044770.1
Coordinates 84407..84823 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M3X93_RS27270 Protein ID WP_001261282.1
Coordinates 84820..85050 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X93_RS27245 (80510) 80510..80782 - 273 Protein_108 transposase -
M3X93_RS27255 (81764) 81764..82786 - 1023 WP_000361404.1 helicase UvrD -
M3X93_RS27260 (82771) 82771..84333 - 1563 WP_004206609.1 AAA family ATPase -
M3X93_RS27265 (84407) 84407..84823 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X93_RS27270 (84820) 84820..85050 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X93_RS27275 (85007) 85007..85468 + 462 WP_160866775.1 hypothetical protein -
M3X93_RS27280 (85638) 85638..85856 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
M3X93_RS27285 (85858) 85858..86163 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
M3X93_RS27290 (86332) 86332..86727 + 396 WP_017899885.1 hypothetical protein -
M3X93_RS27295 (86754) 86754..87068 + 315 WP_053389906.1 hypothetical protein -
M3X93_RS27300 (87079) 87079..88095 + 1017 WP_017899884.1 hypothetical protein -
M3X93_RS27305 (88292) 88292..89086 + 795 WP_004197635.1 site-specific integrase -
M3X93_RS27310 (89558) 89558..89860 - 303 WP_004197636.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaSHV-12 / blaKPC-2 - 1..128678 128678


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T245784 WP_001044770.1 NZ_CP097659:c84823-84407 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT245784 WP_001261282.1 NZ_CP097659:c85050-84820 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References