Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4823689..4824205 | Replicon | chromosome |
Accession | NZ_CP097658 | ||
Organism | Klebsiella pneumoniae strain IR12099_1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | M3X93_RS24025 | Protein ID | WP_002886902.1 |
Coordinates | 4823689..4823973 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M3X93_RS24030 | Protein ID | WP_002886901.1 |
Coordinates | 4823963..4824205 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X93_RS24000 (M3X93_24000) | 4819173..4819436 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
M3X93_RS24005 (M3X93_24005) | 4819566..4819739 | + | 174 | WP_002886906.1 | hypothetical protein | - |
M3X93_RS24010 (M3X93_24010) | 4819742..4820485 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M3X93_RS24015 (M3X93_24015) | 4820842..4822980 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M3X93_RS24020 (M3X93_24020) | 4823221..4823685 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M3X93_RS24025 (M3X93_24025) | 4823689..4823973 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3X93_RS24030 (M3X93_24030) | 4823963..4824205 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3X93_RS24035 (M3X93_24035) | 4824283..4826193 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M3X93_RS24040 (M3X93_24040) | 4826216..4827370 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M3X93_RS24045 (M3X93_24045) | 4827436..4828176 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T245775 WP_002886902.1 NZ_CP097658:c4823973-4823689 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |