Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4103966..4104585 Replicon chromosome
Accession NZ_CP097658
Organism Klebsiella pneumoniae strain IR12099_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X93_RS20560 Protein ID WP_002892050.1
Coordinates 4104367..4104585 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X93_RS20555 Protein ID WP_002892066.1
Coordinates 4103966..4104340 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X93_RS20545 (M3X93_20545) 4099118..4100311 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X93_RS20550 (M3X93_20550) 4100334..4103480 + 3147 WP_186593521.1 multidrug efflux RND transporter permease subunit AcrB -
M3X93_RS20555 (M3X93_20555) 4103966..4104340 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X93_RS20560 (M3X93_20560) 4104367..4104585 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X93_RS20565 (M3X93_20565) 4104744..4105310 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X93_RS20570 (M3X93_20570) 4105282..4105422 - 141 WP_004147370.1 hypothetical protein -
M3X93_RS20575 (M3X93_20575) 4105443..4105913 + 471 WP_002892026.1 YlaC family protein -
M3X93_RS20580 (M3X93_20580) 4105888..4107339 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X93_RS20585 (M3X93_20585) 4107440..4108138 + 699 WP_002892021.1 GNAT family protein -
M3X93_RS20590 (M3X93_20590) 4108135..4108275 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X93_RS20595 (M3X93_20595) 4108275..4108538 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245773 WP_002892050.1 NZ_CP097658:4104367-4104585 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245773 WP_002892066.1 NZ_CP097658:4103966-4104340 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References