245763

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 30888..31368 Replicon plasmid unnamed2
Accession NZ_CP097656
Organism Klebsiella pneumoniae strain IR1272_1

Toxin (Protein)


Gene name TsxA Uniprot ID A0A223LMB9
Locus tag M3T50_RS27855 Protein ID WP_058998978.1
Coordinates 30888..31145 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A223LLF6
Locus tag M3T50_RS27860 Protein ID WP_072223385.1
Coordinates 31135..31368 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T50_RS27815 (M3T50_27815) 26285..26818 - 534 WP_227818513.1 phospholipase D family protein -
M3T50_RS27820 (M3T50_27820) 26793..27245 - 453 WP_058998967.1 hypothetical protein -
M3T50_RS27825 (M3T50_27825) 27250..28278 - 1029 WP_080398146.1 replication initiator protein A -
M3T50_RS27830 (M3T50_27830) 29019..29240 - 222 WP_058998969.1 hypothetical protein -
M3T50_RS27835 (M3T50_27835) 29353..29874 + 522 WP_058998971.1 J domain-containing protein -
M3T50_RS27840 (M3T50_27840) 29916..30131 + 216 WP_058998973.1 hypothetical protein -
M3T50_RS27845 (M3T50_27845) 30143..30349 + 207 WP_058998975.1 hypothetical protein -
M3T50_RS27850 (M3T50_27850) 30349..30891 + 543 WP_058998977.1 hypothetical protein -
M3T50_RS27855 (M3T50_27855) 30888..31145 + 258 WP_058998978.1 hypothetical protein Toxin
M3T50_RS27860 (M3T50_27860) 31135..31368 + 234 WP_072223385.1 hypothetical protein Antitoxin
M3T50_RS27865 (M3T50_27865) 31774..31986 + 213 WP_058998981.1 hypothetical protein -
M3T50_RS27870 (M3T50_27870) 32033..32170 + 138 WP_161400388.1 hypothetical protein -
M3T50_RS27875 (M3T50_27875) 32509..32805 + 297 WP_013583078.1 type II toxin-antitoxin system RelE/ParE family toxin -
M3T50_RS27880 (M3T50_27880) 32807..33091 + 285 WP_058998984.1 putative addiction module antidote protein -
M3T50_RS27885 (M3T50_27885) 33437..33982 + 546 WP_058998986.1 hypothetical protein -
M3T50_RS27890 (M3T50_27890) 33986..35155 + 1170 WP_058998988.1 MobP1 family relaxase -
M3T50_RS27895 (M3T50_27895) 35152..35559 - 408 WP_072223386.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..35800 35800


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(7-36)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 9777.10 Da        Isoelectric Point: 9.3899

>T245763 WP_058998978.1 NZ_CP097656:30888-31145 [Klebsiella pneumoniae]
MKKSKGDAQYYLEKEGDIYHLVKRVKTFSKKLTQGKTKATTKTVSDFSFTKNNFEDIDFNANGLREKDKSIIVQMVEEIE
GLHAD

Download         Length: 258 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8887.37 Da        Isoelectric Point: 8.5202

>AT245763 WP_072223385.1 NZ_CP097656:31135-31368 [Klebsiella pneumoniae]
MLINTPENIKILRKKIGLTQKECAEMFGMTARSWRRKEEPQTTASNTTLSPIEFNYLLLLAGEHPDYVLCKREALHP

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A223LMB9

Antitoxin

Source ID Structure
AlphaFold DB A0A223LLF6

References