Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2988065..2988719 | Replicon | chromosome |
| Accession | NZ_CP097654 | ||
| Organism | Klebsiella pneumoniae strain IR1272_1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R4YHX2 |
| Locus tag | M3T50_RS14605 | Protein ID | WP_004144731.1 |
| Coordinates | 2988312..2988719 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M3T50_RS14600 | Protein ID | WP_002916312.1 |
| Coordinates | 2988065..2988331 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T50_RS14575 (M3T50_14575) | 2983221..2984654 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| M3T50_RS14580 (M3T50_14580) | 2984773..2985501 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| M3T50_RS14585 (M3T50_14585) | 2985551..2985862 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| M3T50_RS14590 (M3T50_14590) | 2986026..2986685 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| M3T50_RS14595 (M3T50_14595) | 2986836..2987819 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| M3T50_RS14600 (M3T50_14600) | 2988065..2988331 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M3T50_RS14605 (M3T50_14605) | 2988312..2988719 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
| M3T50_RS14610 (M3T50_14610) | 2988726..2989247 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| M3T50_RS14615 (M3T50_14615) | 2989348..2990244 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M3T50_RS14620 (M3T50_14620) | 2990267..2990980 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M3T50_RS14625 (M3T50_14625) | 2990986..2992719 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T245751 WP_004144731.1 NZ_CP097654:2988312-2988719 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378E4P6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |