Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2032374..2032999 | Replicon | chromosome |
| Accession | NZ_CP097654 | ||
| Organism | Klebsiella pneumoniae strain IR1272_1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | M3T50_RS09820 | Protein ID | WP_002882817.1 |
| Coordinates | 2032374..2032757 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M3T50_RS09825 | Protein ID | WP_004150355.1 |
| Coordinates | 2032757..2032999 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T50_RS09805 (M3T50_09805) | 2029740..2030642 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M3T50_RS09810 (M3T50_09810) | 2030639..2031274 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M3T50_RS09815 (M3T50_09815) | 2031271..2032200 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M3T50_RS09820 (M3T50_09820) | 2032374..2032757 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3T50_RS09825 (M3T50_09825) | 2032757..2032999 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M3T50_RS09830 (M3T50_09830) | 2033204..2034121 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| M3T50_RS09835 (M3T50_09835) | 2034135..2035076 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M3T50_RS09840 (M3T50_09840) | 2035121..2035558 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M3T50_RS09845 (M3T50_09845) | 2035555..2036415 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
| M3T50_RS09850 (M3T50_09850) | 2036409..2037008 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T245747 WP_002882817.1 NZ_CP097654:c2032757-2032374 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |