Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 834125..834744 Replicon chromosome
Accession NZ_CP097654
Organism Klebsiella pneumoniae strain IR1272_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3T50_RS04070 Protein ID WP_002892050.1
Coordinates 834526..834744 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3T50_RS04065 Protein ID WP_002892066.1
Coordinates 834125..834499 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T50_RS04055 (M3T50_04055) 829277..830470 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3T50_RS04060 (M3T50_04060) 830493..833639 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3T50_RS04065 (M3T50_04065) 834125..834499 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3T50_RS04070 (M3T50_04070) 834526..834744 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3T50_RS04075 (M3T50_04075) 834903..835469 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3T50_RS04080 (M3T50_04080) 835441..835581 - 141 WP_004147370.1 hypothetical protein -
M3T50_RS04085 (M3T50_04085) 835602..836072 + 471 WP_002892026.1 YlaC family protein -
M3T50_RS04090 (M3T50_04090) 836047..837498 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3T50_RS04095 (M3T50_04095) 837599..838297 + 699 WP_002892021.1 GNAT family protein -
M3T50_RS04100 (M3T50_04100) 838294..838434 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3T50_RS04105 (M3T50_04105) 838434..838697 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245743 WP_002892050.1 NZ_CP097654:834526-834744 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245743 WP_002892066.1 NZ_CP097654:834125-834499 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References