Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 216797..217707 Replicon plasmid unnamed
Accession NZ_CP097652
Organism Klebsiella pneumoniae strain NK01067

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag M8Y62_RS27055 Protein ID WP_004026354.1
Coordinates 217237..217707 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag M8Y62_RS27050 Protein ID WP_004026357.1
Coordinates 216797..217240 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y62_RS27020 (M8Y62_27020) 211815..212336 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
M8Y62_RS27025 (M8Y62_27025) 212333..213286 + 954 Protein_228 ferric citrate uptake sigma factor regulator FecR -
M8Y62_RS27030 (M8Y62_27030) 213373..215499 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
M8Y62_RS27035 (M8Y62_27035) 215574..215699 + 126 Protein_230 Fe3+-citrate ABC transporter substrate-binding protein -
M8Y62_RS27040 (M8Y62_27040) 215874..216095 + 222 WP_004213643.1 DUF2188 domain-containing protein -
M8Y62_RS27045 (M8Y62_27045) 216193..216696 + 504 Protein_232 DUF4113 domain-containing protein -
M8Y62_RS27050 (M8Y62_27050) 216797..217240 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
M8Y62_RS27055 (M8Y62_27055) 217237..217707 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
M8Y62_RS27060 (M8Y62_27060) 217856..218553 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
M8Y62_RS27065 (M8Y62_27065) 218555..219004 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
M8Y62_RS27070 (M8Y62_27070) 219021..219332 + 312 WP_011251282.1 hypothetical protein -
M8Y62_RS27075 (M8Y62_27075) 219346..219687 + 342 WP_011251281.1 hypothetical protein -
M8Y62_RS27080 (M8Y62_27080) 219747..220703 + 957 WP_011251280.1 DsbA family protein -
M8Y62_RS27085 (M8Y62_27085) 220820..221395 + 576 WP_074424927.1 hypothetical protein -
M8Y62_RS27090 (M8Y62_27090) 221503..222018 + 516 WP_041937820.1 hypothetical protein -
M8Y62_RS27095 (M8Y62_27095) 222021..222623 + 603 WP_011251277.1 HAD domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..232508 232508
- flank IS/Tn - - 218050..218553 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T245742 WP_004026354.1 NZ_CP097652:217237-217707 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT245742 WP_004026357.1 NZ_CP097652:216797-217240 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References