Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 165570..166240 Replicon plasmid unnamed
Accession NZ_CP097652
Organism Klebsiella pneumoniae strain NK01067

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag M8Y62_RS26760 Protein ID WP_004213072.1
Coordinates 165797..166240 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag M8Y62_RS26755 Protein ID WP_004213073.1
Coordinates 165570..165800 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y62_RS26730 (M8Y62_26730) 161793..162692 - 900 WP_004225022.1 nucleotide-binding protein -
M8Y62_RS26735 (M8Y62_26735) 162682..162972 - 291 WP_004213078.1 hypothetical protein -
M8Y62_RS26740 (M8Y62_26740) 163324..163530 + 207 WP_004213077.1 hypothetical protein -
M8Y62_RS26745 (M8Y62_26745) 163520..163813 - 294 WP_004213076.1 hypothetical protein -
M8Y62_RS26750 (M8Y62_26750) 163829..164962 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
M8Y62_RS26755 (M8Y62_26755) 165570..165800 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M8Y62_RS26760 (M8Y62_26760) 165797..166240 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
M8Y62_RS26765 (M8Y62_26765) 166389..166640 + 252 WP_186987481.1 hypothetical protein -
M8Y62_RS26770 (M8Y62_26770) 166663..166967 - 305 Protein_177 transposase -
M8Y62_RS26775 (M8Y62_26775) 167384..168021 + 638 Protein_178 mucoid phenotype regulator RmpA2 -
M8Y62_RS26780 (M8Y62_26780) 168539..168942 - 404 Protein_179 GAF domain-containing protein -
M8Y62_RS26785 (M8Y62_26785) 169033..169953 - 921 WP_004213934.1 DUF1471 domain-containing protein -
M8Y62_RS26790 (M8Y62_26790) 170002..170493 - 492 WP_011251327.1 DM13 domain-containing protein -
M8Y62_RS26795 (M8Y62_26795) 170556..170831 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..232508 232508


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T245741 WP_004213072.1 NZ_CP097652:165797-166240 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT245741 WP_004213073.1 NZ_CP097652:165570-165800 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References