Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5322347..5322972 | Replicon | chromosome |
| Accession | NZ_CP097651 | ||
| Organism | Klebsiella pneumoniae strain NK01067 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A330XB05 |
| Locus tag | M8Y62_RS25530 | Protein ID | WP_012737091.1 |
| Coordinates | 5322347..5322730 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M8Y62_RS25535 | Protein ID | WP_004150355.1 |
| Coordinates | 5322730..5322972 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y62_RS25515 (5319713) | 5319713..5320615 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M8Y62_RS25520 (5320612) | 5320612..5321247 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M8Y62_RS25525 (5321244) | 5321244..5322173 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M8Y62_RS25530 (5322347) | 5322347..5322730 | - | 384 | WP_012737091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M8Y62_RS25535 (5322730) | 5322730..5322972 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M8Y62_RS25540 (5323177) | 5323177..5324094 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| M8Y62_RS25545 (5324108) | 5324108..5325049 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M8Y62_RS25550 (5325094) | 5325094..5325531 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M8Y62_RS25555 (5325528) | 5325528..5326388 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M8Y62_RS25560 (5326382) | 5326382..5326981 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14266.53 Da Isoelectric Point: 7.2771
>T245739 WP_012737091.1 NZ_CP097651:c5322730-5322347 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330XB05 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |