Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4851113..4851629 | Replicon | chromosome |
Accession | NZ_CP097651 | ||
Organism | Klebsiella pneumoniae strain NK01067 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M8Y62_RS23280 | Protein ID | WP_004178374.1 |
Coordinates | 4851113..4851397 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M8Y62_RS23285 | Protein ID | WP_002886901.1 |
Coordinates | 4851387..4851629 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y62_RS23255 (4846509) | 4846509..4846772 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
M8Y62_RS23260 (4846902) | 4846902..4847075 | + | 174 | WP_041169004.1 | hypothetical protein | - |
M8Y62_RS23265 (4847078) | 4847078..4847821 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M8Y62_RS23270 (4848178) | 4848178..4850316 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M8Y62_RS23275 (4850645) | 4850645..4851109 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M8Y62_RS23280 (4851113) | 4851113..4851397 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8Y62_RS23285 (4851387) | 4851387..4851629 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M8Y62_RS23290 (4851707) | 4851707..4853617 | - | 1911 | WP_012737231.1 | PRD domain-containing protein | - |
M8Y62_RS23295 (4853640) | 4853640..4854794 | - | 1155 | WP_012737230.1 | lactonase family protein | - |
M8Y62_RS23300 (4854861) | 4854861..4855601 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T245738 WP_004178374.1 NZ_CP097651:c4851397-4851113 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |