Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4092495..4093114 Replicon chromosome
Accession NZ_CP097651
Organism Klebsiella pneumoniae strain NK01067

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M8Y62_RS19715 Protein ID WP_002892050.1
Coordinates 4092896..4093114 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M8Y62_RS19710 Protein ID WP_002892066.1
Coordinates 4092495..4092869 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y62_RS19700 (4087647) 4087647..4088840 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M8Y62_RS19705 (4088863) 4088863..4092009 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M8Y62_RS19710 (4092495) 4092495..4092869 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M8Y62_RS19715 (4092896) 4092896..4093114 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M8Y62_RS19720 (4093273) 4093273..4093839 + 567 WP_002892030.1 maltose O-acetyltransferase -
M8Y62_RS19725 (4093811) 4093811..4093951 - 141 WP_004147370.1 hypothetical protein -
M8Y62_RS19730 (4093972) 4093972..4094442 + 471 WP_002892026.1 YlaC family protein -
M8Y62_RS19735 (4094417) 4094417..4095868 - 1452 WP_014907971.1 PLP-dependent aminotransferase family protein -
M8Y62_RS19740 (4095969) 4095969..4096667 + 699 WP_002892021.1 GNAT family protein -
M8Y62_RS19745 (4096664) 4096664..4096804 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M8Y62_RS19750 (4096804) 4096804..4097067 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245736 WP_002892050.1 NZ_CP097651:4092896-4093114 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245736 WP_002892066.1 NZ_CP097651:4092495-4092869 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References