Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4092495..4093114 | Replicon | chromosome |
Accession | NZ_CP097651 | ||
Organism | Klebsiella pneumoniae strain NK01067 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M8Y62_RS19715 | Protein ID | WP_002892050.1 |
Coordinates | 4092896..4093114 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M8Y62_RS19710 | Protein ID | WP_002892066.1 |
Coordinates | 4092495..4092869 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y62_RS19700 (4087647) | 4087647..4088840 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M8Y62_RS19705 (4088863) | 4088863..4092009 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M8Y62_RS19710 (4092495) | 4092495..4092869 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M8Y62_RS19715 (4092896) | 4092896..4093114 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M8Y62_RS19720 (4093273) | 4093273..4093839 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M8Y62_RS19725 (4093811) | 4093811..4093951 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M8Y62_RS19730 (4093972) | 4093972..4094442 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M8Y62_RS19735 (4094417) | 4094417..4095868 | - | 1452 | WP_014907971.1 | PLP-dependent aminotransferase family protein | - |
M8Y62_RS19740 (4095969) | 4095969..4096667 | + | 699 | WP_002892021.1 | GNAT family protein | - |
M8Y62_RS19745 (4096664) | 4096664..4096804 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M8Y62_RS19750 (4096804) | 4096804..4097067 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245736 WP_002892050.1 NZ_CP097651:4092896-4093114 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT245736 WP_002892066.1 NZ_CP097651:4092495-4092869 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |