Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 799571..800228 | Replicon | chromosome |
| Accession | NZ_CP097651 | ||
| Organism | Klebsiella pneumoniae strain NK01067 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | M8Y62_RS03965 | Protein ID | WP_002916310.1 |
| Coordinates | 799818..800228 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M8Y62_RS03960 | Protein ID | WP_002916312.1 |
| Coordinates | 799571..799837 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y62_RS03935 (794779) | 794779..796212 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| M8Y62_RS03940 (796331) | 796331..797059 | - | 729 | WP_048336809.1 | MurR/RpiR family transcriptional regulator | - |
| M8Y62_RS03945 (797109) | 797109..797420 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| M8Y62_RS03950 (797584) | 797584..798243 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| M8Y62_RS03955 (798342) | 798342..799325 | - | 984 | WP_014906951.1 | tRNA-modifying protein YgfZ | - |
| M8Y62_RS03960 (799571) | 799571..799837 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M8Y62_RS03965 (799818) | 799818..800228 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| M8Y62_RS03970 (800235) | 800235..800756 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| M8Y62_RS03975 (800857) | 800857..801753 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M8Y62_RS03980 (801776) | 801776..802489 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M8Y62_RS03985 (802495) | 802495..804228 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T245730 WP_002916310.1 NZ_CP097651:799818-800228 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |