Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2861989..2862653 Replicon chromosome
Accession NZ_CP097649
Organism Brevundimonas albigilva strain TT17

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M8231_RS14225 Protein ID WP_249749423.1
Coordinates 2862237..2862653 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag M8231_RS14220 Protein ID WP_249749424.1
Coordinates 2861989..2862216 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8231_RS14200 (M8231_14200) 2857608..2858474 - 867 WP_249749427.1 tol-pal system protein -
M8231_RS14205 (M8231_14205) 2858525..2859646 - 1122 WP_249749426.1 DUF3667 domain-containing protein -
M8231_RS14210 (M8231_14210) 2859754..2860311 - 558 WP_250201758.1 peptidoglycan-associated lipoprotein Pal -
M8231_RS14215 (M8231_14215) 2860459..2861847 - 1389 WP_250201759.1 Tol-Pal system beta propeller repeat protein TolB -
M8231_RS14220 (M8231_14220) 2861989..2862216 + 228 WP_249749424.1 CopG family transcriptional regulator Antitoxin
M8231_RS14225 (M8231_14225) 2862237..2862653 + 417 WP_249749423.1 VapC toxin family PIN domain ribonuclease Toxin
M8231_RS14230 (M8231_14230) 2862654..2863487 - 834 WP_250201760.1 hypothetical protein -
M8231_RS14235 (M8231_14235) 2863490..2863975 - 486 WP_249749422.1 ExbD/TolR family protein -
M8231_RS14240 (M8231_14240) 2863977..2864729 - 753 WP_250201761.1 protein TolQ -
M8231_RS14245 (M8231_14245) 2864860..2865288 - 429 WP_250201762.1 hypothetical protein -
M8231_RS14250 (M8231_14250) 2865313..2865774 - 462 WP_283843576.1 tol-pal system-associated acyl-CoA thioesterase -
M8231_RS14255 (M8231_14255) 2865784..2866176 - 393 WP_249749420.1 hypothetical protein -
M8231_RS14260 (M8231_14260) 2866212..2867255 - 1044 WP_250201763.1 Holliday junction branch migration DNA helicase RuvB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-119)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15112.33 Da        Isoelectric Point: 8.1147

>T245726 WP_249749423.1 NZ_CP097649:2862237-2862653 [Brevundimonas albigilva]
VLIALVDPRHVFHDPANAWFHREAVASWATCPITENGLVRIVGSNRYRNPVGPPSEVLRILDLLRDMRGHVFWPDTVSLA
NGRLFNPSALTAPEQITDAYLLALAVSNGGLLATFDRRLSPDAVKGGRAALHLIADTR

Download         Length: 417 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8318.48 Da        Isoelectric Point: 5.7810

>AT245726 WP_249749424.1 NZ_CP097649:2861989-2862216 [Brevundimonas albigilva]
MRTTLAIDDDVLNAARAIAAHQDRTVGEVLSELARQTLQKRPTTTRFRNGVPLLPDRPGPMVTLEDVNALRDELP

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References