Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 823402..824075 | Replicon | chromosome |
Accession | NZ_CP097649 | ||
Organism | Brevundimonas albigilva strain TT17 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M8231_RS04075 | Protein ID | WP_250202315.1 |
Coordinates | 823402..823824 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M8231_RS04080 | Protein ID | WP_250202316.1 |
Coordinates | 823863..824075 (-) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8231_RS04040 (M8231_04040) | 819227..819508 | - | 282 | WP_250202309.1 | helix-turn-helix domain-containing protein | - |
M8231_RS04045 (M8231_04045) | 819644..820174 | - | 531 | WP_250202310.1 | DUF2285 domain-containing protein | - |
M8231_RS04050 (M8231_04050) | 820533..820793 | - | 261 | WP_250202311.1 | DUF2285 domain-containing protein | - |
M8231_RS04055 (M8231_04055) | 820890..821156 | - | 267 | WP_250202312.1 | helix-turn-helix transcriptional regulator | - |
M8231_RS04060 (M8231_04060) | 821476..821802 | - | 327 | WP_250202313.1 | DUF736 domain-containing protein | - |
M8231_RS04065 (M8231_04065) | 822376..822816 | - | 441 | WP_250202314.1 | hypothetical protein | - |
M8231_RS04070 (M8231_04070) | 822949..823116 | - | 168 | WP_169800607.1 | hypothetical protein | - |
M8231_RS04075 (M8231_04075) | 823402..823824 | - | 423 | WP_250202315.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M8231_RS04080 (M8231_04080) | 823863..824075 | - | 213 | WP_250202316.1 | plasmid stabilization protein | Antitoxin |
M8231_RS04085 (M8231_04085) | 824160..825086 | - | 927 | WP_250202317.1 | DUF2493 domain-containing protein | - |
M8231_RS04090 (M8231_04090) | 825479..825649 | + | 171 | WP_250202318.1 | hypothetical protein | - |
M8231_RS04095 (M8231_04095) | 825670..825981 | + | 312 | WP_250202319.1 | helix-turn-helix transcriptional regulator | - |
M8231_RS04100 (M8231_04100) | 825974..827227 | + | 1254 | WP_250202320.1 | HipA domain-containing protein | - |
M8231_RS04105 (M8231_04105) | 827249..828313 | - | 1065 | WP_250202321.1 | toprim domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15082.22 Da Isoelectric Point: 4.4891
>T245722 WP_250202315.1 NZ_CP097649:c823824-823402 [Brevundimonas albigilva]
MILLNTNVVSEAMKPAPDEAVRTWLDEQAAETLFLSSVTIAELMFGIGALPDGRRKDRLTDALDGVMELFTDRILPFDID
AARHYADLAVKARAAGKGFPTPDGYIAAIAAAKGFVVATRDTSAFDAANVEVIDPWKTGR
MILLNTNVVSEAMKPAPDEAVRTWLDEQAAETLFLSSVTIAELMFGIGALPDGRRKDRLTDALDGVMELFTDRILPFDID
AARHYADLAVKARAAGKGFPTPDGYIAAIAAAKGFVVATRDTSAFDAANVEVIDPWKTGR
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|