Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 110685..111421 | Replicon | plasmid pKqu-1 |
Accession | NZ_CP097647 | ||
Organism | Klebsiella quasipneumoniae strain NE1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | M8232_RS25415 | Protein ID | WP_003026803.1 |
Coordinates | 110685..111167 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | M8232_RS25420 | Protein ID | WP_003026799.1 |
Coordinates | 111155..111421 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8232_RS25400 (M8232_25400) | 107664..108236 | + | 573 | WP_250202730.1 | recombinase family protein | - |
M8232_RS25405 (M8232_25405) | 108245..109063 | + | 819 | WP_250202731.1 | abortive infection family protein | - |
M8232_RS25410 (M8232_25410) | 109134..110477 | - | 1344 | WP_136697913.1 | ISNCY family transposase | - |
M8232_RS25415 (M8232_25415) | 110685..111167 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
M8232_RS25420 (M8232_25420) | 111155..111421 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
M8232_RS25425 (M8232_25425) | 111682..112650 | + | 969 | WP_072202995.1 | IS5 family transposase | - |
M8232_RS25430 (M8232_25430) | 112754..113874 | + | 1121 | WP_085950818.1 | IS3-like element ISSen4 family transposase | - |
M8232_RS25435 (M8232_25435) | 114102..115055 | + | 954 | WP_001198018.1 | cation diffusion facilitator family transporter | - |
M8232_RS25440 (M8232_25440) | 115167..115541 | + | 375 | WP_011977761.1 | cytochrome b562 | - |
M8232_RS25445 (M8232_25445) | 115979..116077 | + | 99 | Protein_133 | cytochrome b/b6 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkF / mrkJ / pla | 1..181209 | 181209 | |
- | inside | IScluster/Tn | - | - | 104911..117128 | 12217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T245721 WP_003026803.1 NZ_CP097647:c111167-110685 [Klebsiella quasipneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |