Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 37909..38431 | Replicon | plasmid pKqu-1 |
Accession | NZ_CP097647 | ||
Organism | Klebsiella quasipneumoniae strain NE1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A9J6S4Z8 |
Locus tag | M8232_RS25020 | Protein ID | WP_004187019.1 |
Coordinates | 37909..38193 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4ZSR4 |
Locus tag | M8232_RS25025 | Protein ID | WP_004187025.1 |
Coordinates | 38183..38431 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8232_RS24990 (M8232_24990) | 33269..33697 | + | 429 | WP_035897523.1 | glutaredoxin-dependent arsenate reductase | - |
M8232_RS24995 (M8232_24995) | 33983..34771 | + | 789 | Protein_43 | ISNCY family transposase | - |
M8232_RS25000 (M8232_25000) | 34860..36088 | + | 1229 | WP_094081435.1 | IS3 family transposase | - |
M8232_RS25005 (M8232_25005) | 36101..36277 | + | 177 | Protein_45 | transposase | - |
M8232_RS25015 (M8232_25015) | 37501..37893 | + | 393 | Protein_47 | transposase | - |
M8232_RS25020 (M8232_25020) | 37909..38193 | - | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8232_RS25025 (M8232_25025) | 38183..38431 | - | 249 | WP_004187025.1 | plasmid stabilization protein | Antitoxin |
M8232_RS25030 (M8232_25030) | 38806..39204 | - | 399 | WP_049084174.1 | helix-turn-helix domain-containing protein | - |
M8232_RS25035 (M8232_25035) | 39253..40599 | - | 1347 | WP_250202749.1 | ISNCY family transposase | - |
M8232_RS25040 (M8232_25040) | 40719..41498 | + | 780 | WP_250202743.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkF / mrkJ / pla | 1..181209 | 181209 | |
- | inside | IScluster/Tn | - | - | 34860..43442 | 8582 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11003.72 Da Isoelectric Point: 10.5388
>T245720 WP_004187019.1 NZ_CP097647:c38193-37909 [Klebsiella quasipneumoniae]
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|