Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 23998..24908 | Replicon | plasmid pKqu-1 |
Accession | NZ_CP097647 | ||
Organism | Klebsiella quasipneumoniae strain NE1 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A2A5MBW7 |
Locus tag | M8232_RS24940 | Protein ID | WP_023329005.1 |
Coordinates | 24438..24908 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A9J6S5L1 |
Locus tag | M8232_RS24935 | Protein ID | WP_049084156.1 |
Coordinates | 23998..24441 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8232_RS24910 (M8232_24910) | 19890..20120 | - | 231 | Protein_26 | hypothetical protein | - |
M8232_RS24915 (M8232_24915) | 20319..21040 | + | 722 | Protein_27 | DUF969 domain-containing protein | - |
M8232_RS24920 (M8232_24920) | 21037..22023 | + | 987 | Protein_28 | DUF979 domain-containing protein | - |
M8232_RS24925 (M8232_24925) | 22033..23028 | + | 996 | WP_032731961.1 | DUF2891 domain-containing protein | - |
M8232_RS24930 (M8232_24930) | 23210..23876 | + | 667 | Protein_30 | DUF4113 domain-containing protein | - |
M8232_RS24935 (M8232_24935) | 23998..24441 | + | 444 | WP_049084156.1 | DUF2384 domain-containing protein | Antitoxin |
M8232_RS24940 (M8232_24940) | 24438..24908 | + | 471 | WP_023329005.1 | RES family NAD+ phosphorylase | Toxin |
M8232_RS24945 (M8232_24945) | 25211..26179 | - | 969 | WP_000654811.1 | IS5 family transposase | - |
M8232_RS24950 (M8232_24950) | 26197..26343 | - | 147 | WP_250202739.1 | hypothetical protein | - |
M8232_RS24955 (M8232_24955) | 27038..28413 | + | 1376 | WP_250202740.1 | IS3 family transposase | - |
M8232_RS24960 (M8232_24960) | 28662..29237 | - | 576 | WP_032731970.1 | cytochrome b/b6 domain-containing protein | - |
M8232_RS24965 (M8232_24965) | 29385..29690 | + | 306 | WP_023328906.1 | metalloregulator ArsR/SmtB family transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkF / mrkJ / pla | 1..181209 | 181209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17459.70 Da Isoelectric Point: 4.4829
>T245719 WP_023329005.1 NZ_CP097647:24438-24908 [Klebsiella quasipneumoniae]
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIPFRFDSRLKPDRK
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16447.80 Da Isoelectric Point: 10.2498
>AT245719 WP_049084156.1 NZ_CP097647:23998-24441 [Klebsiella quasipneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|