Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3901466..3902085 Replicon chromosome
Accession NZ_CP097646
Organism Klebsiella quasipneumoniae strain NE1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M8232_RS18905 Protein ID WP_002892050.1
Coordinates 3901867..3902085 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M8232_RS18900 Protein ID WP_002892066.1
Coordinates 3901466..3901840 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8232_RS18890 (3896619) 3896619..3897812 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M8232_RS18895 (3897835) 3897835..3900981 + 3147 WP_004204748.1 multidrug efflux RND transporter permease subunit AcrB -
M8232_RS18900 (3901466) 3901466..3901840 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M8232_RS18905 (3901867) 3901867..3902085 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M8232_RS18910 (3902244) 3902244..3902810 + 567 WP_156234437.1 maltose O-acetyltransferase -
M8232_RS18915 (3902782) 3902782..3902904 - 123 WP_032426076.1 hypothetical protein -
M8232_RS18920 (3902947) 3902947..3903417 + 471 WP_004204751.1 YlaC family protein -
M8232_RS18925 (3903386) 3903386..3904843 - 1458 WP_250202695.1 PLP-dependent aminotransferase family protein -
M8232_RS18930 (3904944) 3904944..3905642 + 699 WP_156234441.1 GNAT family protein -
M8232_RS18935 (3905639) 3905639..3905779 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M8232_RS18940 (3905779) 3905779..3906042 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245717 WP_002892050.1 NZ_CP097646:3901867-3902085 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245717 WP_002892066.1 NZ_CP097646:3901466-3901840 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References