Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 2491575..2493163 | Replicon | chromosome |
Accession | NZ_CP097646 | ||
Organism | Klebsiella quasipneumoniae strain NE1 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | M8232_RS12065 | Protein ID | WP_004205919.1 |
Coordinates | 2491575..2492897 (-) | Length | 441 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | A0A2A5MFC9 |
Locus tag | M8232_RS12070 | Protein ID | WP_004205921.1 |
Coordinates | 2492897..2493163 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8232_RS12030 (2486657) | 2486657..2486875 | + | 219 | WP_002904808.1 | ParD-like family protein | - |
M8232_RS12035 (2486856) | 2486856..2487638 | + | 783 | WP_048294851.1 | type I methionyl aminopeptidase | - |
M8232_RS12040 (2487907) | 2487907..2489022 | + | 1116 | WP_156234679.1 | serine hydrolase domain-containing protein | - |
M8232_RS12045 (2489009) | 2489009..2489353 | + | 345 | WP_004205915.1 | hypothetical protein | - |
M8232_RS12050 (2489382) | 2489382..2489915 | + | 534 | WP_004205916.1 | hypothetical protein | - |
M8232_RS12055 (2489918) | 2489918..2490124 | + | 207 | WP_004205917.1 | helix-turn-helix transcriptional regulator | - |
M8232_RS12060 (2490266) | 2490266..2491558 | + | 1293 | WP_004205918.1 | glycoside hydrolase family 10 protein | - |
M8232_RS12065 (2491575) | 2491575..2492897 | - | 1323 | WP_004205919.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
M8232_RS12070 (2492897) | 2492897..2493163 | - | 267 | WP_004205921.1 | type II toxin-antitoxin system antitoxin HipB | Antitoxin |
M8232_RS12075 (2493446) | 2493446..2493772 | - | 327 | WP_069602708.1 | hydroxyisourate hydrolase | - |
M8232_RS12080 (2493769) | 2493769..2494269 | - | 501 | WP_017900378.1 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | - |
M8232_RS12085 (2494247) | 2494247..2495626 | - | 1380 | WP_156234680.1 | nucleobase:cation symporter-2 family protein | - |
M8232_RS12090 (2495972) | 2495972..2497126 | + | 1155 | WP_004205928.1 | FAD-dependent urate hydroxylase HpxO | - |
M8232_RS12095 (2497107) | 2497107..2498030 | - | 924 | WP_004205929.1 | LysR family hpxDE operon transcriptional regulator HpxR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | blaOKP-B-15 | mgtC / iroE / sciN/tssJ / tssG / tssF / icmF/tssM / KPHS_23120 / tle1 / tli1 / tli1 / tli1 / tli1 / tle1 / tli1 / tli1 / tli1 / vgrG/tssI / clpV/tssH / hcp/tssD / dotU/tssL / vasE/tssK / vipB/tssC / vipA/tssB | 2330318..2871387 | 541069 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 441 a.a. Molecular weight: 49013.27 Da Isoelectric Point: 8.2655
>T245715 WP_004205919.1 NZ_CP097646:c2492897-2491575 [Klebsiella quasipneumoniae]
MATLTTWMNNARVGTLTRQANGAHSFRYDEEWLRSPRARPLSLSLPLQYGNITADAVYHYFDNLLPDSPQVRERIVRRYQ
ARSKQPFDLLAEVGRDSVGAVTLLPPGEEAHLAALRWQTLDEAQLTALLTAYQSDIPLGMVTGQDDFRISVAGAQEKTAL
LRMGEHWCIPQGTTPTTHIIKLPIGEIKQPNATLDLRESVDNEYLCLALARALGLAVPEAEIINTPRIRALAVTRFDRRW
AQEGRVLLRLPQEDLCQAFGIPSSMKYESDGGPGIAAIMTFLLGSSEALKDRYDFMKFMVFQWLTGATDGHAKNFSLFLL
PGGSYRLTPFYDIISAFPVLGGTGLHLRDLKLSMGLNATKGRKTEINAIYPRHFLATAKAVNFPREQMLAILGEFADRVP
QAIESARQTLPSDFSAHVWRAITENMLKLHARLQQGLQAG
MATLTTWMNNARVGTLTRQANGAHSFRYDEEWLRSPRARPLSLSLPLQYGNITADAVYHYFDNLLPDSPQVRERIVRRYQ
ARSKQPFDLLAEVGRDSVGAVTLLPPGEEAHLAALRWQTLDEAQLTALLTAYQSDIPLGMVTGQDDFRISVAGAQEKTAL
LRMGEHWCIPQGTTPTTHIIKLPIGEIKQPNATLDLRESVDNEYLCLALARALGLAVPEAEIINTPRIRALAVTRFDRRW
AQEGRVLLRLPQEDLCQAFGIPSSMKYESDGGPGIAAIMTFLLGSSEALKDRYDFMKFMVFQWLTGATDGHAKNFSLFLL
PGGSYRLTPFYDIISAFPVLGGTGLHLRDLKLSMGLNATKGRKTEINAIYPRHFLATAKAVNFPREQMLAILGEFADRVP
QAIESARQTLPSDFSAHVWRAITENMLKLHARLQQGLQAG
Download Length: 1323 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|