Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 779521..780178 | Replicon | chromosome |
Accession | NZ_CP097646 | ||
Organism | Klebsiella quasipneumoniae strain NE1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2A5MNX1 |
Locus tag | M8232_RS03840 | Protein ID | WP_004205323.1 |
Coordinates | 779768..780178 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M8232_RS03835 | Protein ID | WP_002916312.1 |
Coordinates | 779521..779787 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8232_RS03810 (774729) | 774729..776162 | - | 1434 | WP_004205314.1 | 6-phospho-beta-glucosidase BglA | - |
M8232_RS03815 (776281) | 776281..777009 | - | 729 | WP_004205316.1 | MurR/RpiR family transcriptional regulator | - |
M8232_RS03820 (777060) | 777060..777371 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M8232_RS03825 (777534) | 777534..778193 | + | 660 | WP_004205319.1 | hemolysin III family protein | - |
M8232_RS03830 (778292) | 778292..779275 | - | 984 | WP_048295573.1 | tRNA-modifying protein YgfZ | - |
M8232_RS03835 (779521) | 779521..779787 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M8232_RS03840 (779768) | 779768..780178 | + | 411 | WP_004205323.1 | protein YgfX | Toxin |
M8232_RS03845 (780185) | 780185..780706 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
M8232_RS03850 (780807) | 780807..781703 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M8232_RS03855 (781726) | 781726..782439 | + | 714 | WP_004205326.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M8232_RS03860 (782445) | 782445..784178 | + | 1734 | WP_004205327.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T245709 WP_004205323.1 NZ_CP097646:779768-780178 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MNX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |