Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 316192..316778 | Replicon | chromosome |
| Accession | NZ_CP097646 | ||
| Organism | Klebsiella quasipneumoniae strain NE1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | M8232_RS01440 | Protein ID | WP_002920800.1 |
| Coordinates | 316410..316778 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | M8232_RS01435 | Protein ID | WP_040221757.1 |
| Coordinates | 316192..316413 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8232_RS01415 (312349) | 312349..313275 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M8232_RS01420 (313272) | 313272..314549 | + | 1278 | WP_004202111.1 | branched chain amino acid ABC transporter permease LivM | - |
| M8232_RS01425 (314546) | 314546..315313 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| M8232_RS01430 (315315) | 315315..316028 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| M8232_RS01435 (316192) | 316192..316413 | + | 222 | WP_040221757.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M8232_RS01440 (316410) | 316410..316778 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M8232_RS01445 (317128) | 317128..318444 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| M8232_RS01450 (318551) | 318551..319438 | + | 888 | WP_004202113.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| M8232_RS01455 (319435) | 319435..320280 | + | 846 | WP_023319266.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| M8232_RS01460 (320282) | 320282..321352 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 313272..322089 | 8817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T245708 WP_002920800.1 NZ_CP097646:316410-316778 [Klebsiella quasipneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|