Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316192..316778 Replicon chromosome
Accession NZ_CP097646
Organism Klebsiella quasipneumoniae strain NE1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M8232_RS01440 Protein ID WP_002920800.1
Coordinates 316410..316778 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag M8232_RS01435 Protein ID WP_040221757.1
Coordinates 316192..316413 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8232_RS01415 (312349) 312349..313275 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M8232_RS01420 (313272) 313272..314549 + 1278 WP_004202111.1 branched chain amino acid ABC transporter permease LivM -
M8232_RS01425 (314546) 314546..315313 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M8232_RS01430 (315315) 315315..316028 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M8232_RS01435 (316192) 316192..316413 + 222 WP_040221757.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M8232_RS01440 (316410) 316410..316778 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M8232_RS01445 (317128) 317128..318444 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M8232_RS01450 (318551) 318551..319438 + 888 WP_004202113.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M8232_RS01455 (319435) 319435..320280 + 846 WP_023319266.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M8232_RS01460 (320282) 320282..321352 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 313272..322089 8817


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T245708 WP_002920800.1 NZ_CP097646:316410-316778 [Klebsiella quasipneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.12 Da        Isoelectric Point: 4.7769

>AT245708 WP_040221757.1 NZ_CP097646:316192-316413 [Klebsiella quasipneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARIDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure

References