Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 7015..7595 | Replicon | plasmid p3_140253 |
| Accession | NZ_CP097630 | ||
| Organism | Klebsiella pneumoniae strain 140253 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8J3DTL7 |
| Locus tag | M9P58_RS29410 | Protein ID | WP_071177730.1 |
| Coordinates | 7281..7595 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1PRM1 |
| Locus tag | M9P58_RS29405 | Protein ID | WP_000093040.1 |
| Coordinates | 7015..7293 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9P58_RS29375 (M9P58_29375) | 3075..3224 | - | 150 | WP_032440454.1 | colicin release lysis protein | - |
| M9P58_RS29380 (M9P58_29380) | 3309..3566 | - | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
| M9P58_RS29385 (M9P58_29385) | 3576..5261 | - | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
| M9P58_RS29390 (M9P58_29390) | 5588..5833 | + | 246 | WP_032440458.1 | hypothetical protein | - |
| M9P58_RS29395 (M9P58_29395) | 6107..6478 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
| M9P58_RS29400 (M9P58_29400) | 6475..6840 | + | 366 | WP_072354022.1 | TonB family protein | - |
| M9P58_RS29405 (M9P58_29405) | 7015..7293 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M9P58_RS29410 (M9P58_29410) | 7281..7595 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9P58_RS29415 (M9P58_29415) | 7759..8187 | + | 429 | WP_001140599.1 | hypothetical protein | - |
| M9P58_RS29420 (M9P58_29420) | 8213..8392 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
| M9P58_RS29425 (M9P58_29425) | 8419..8949 | - | 531 | WP_071177729.1 | hypothetical protein | - |
| M9P58_RS29430 (M9P58_29430) | 8956..9687 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T245699 WP_071177730.1 NZ_CP097630:7281-7595 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|