Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 182876..183519 Replicon plasmid p1_140253
Accession NZ_CP097628
Organism Klebsiella pneumoniae strain 140253

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag M9P58_RS28990 Protein ID WP_014386165.1
Coordinates 183103..183519 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag M9P58_RS28985 Protein ID WP_032408893.1
Coordinates 182876..183106 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9P58_RS28960 (M9P58_28960) 177949..178932 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
M9P58_RS28965 (M9P58_28965) 178951..180099 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
M9P58_RS28970 (M9P58_28970) 180270..181427 - 1158 WP_032408895.1 acetylornithine deacetylase -
M9P58_RS28975 (M9P58_28975) 181443..182117 - 675 WP_014386166.1 DUF1028 domain-containing protein -
M9P58_RS28980 (M9P58_28980) 182122..182556 - 435 WP_000103648.1 RidA family protein -
M9P58_RS28985 (M9P58_28985) 182876..183106 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9P58_RS28990 (M9P58_28990) 183103..183519 + 417 WP_014386165.1 PIN domain-containing protein Toxin
M9P58_RS28995 (M9P58_28995) 183842..184810 + 969 WP_074422984.1 IS5-like element IS903B family transposase -
M9P58_RS29000 (M9P58_29000) 184990..185364 - 375 WP_032408891.1 hypothetical protein -
M9P58_RS29005 (M9P58_29005) 185420..185746 - 327 WP_004152639.1 hypothetical protein -
M9P58_RS29010 (M9P58_29010) 185743..186471 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
M9P58_RS29015 (M9P58_29015) 186468..186899 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / dfrA12 / aadA2 / qacE / sul1 / mph(A) - 1..205645 205645
- flank IS/Tn - - 183842..184810 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T245698 WP_014386165.1 NZ_CP097628:183103-183519 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT245698 WP_032408893.1 NZ_CP097628:182876-183106 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References