Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 182876..183519 | Replicon | plasmid p1_140253 |
| Accession | NZ_CP097628 | ||
| Organism | Klebsiella pneumoniae strain 140253 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | M9P58_RS28990 | Protein ID | WP_014386165.1 |
| Coordinates | 183103..183519 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | M9P58_RS28985 | Protein ID | WP_032408893.1 |
| Coordinates | 182876..183106 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9P58_RS28960 (M9P58_28960) | 177949..178932 | - | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
| M9P58_RS28965 (M9P58_28965) | 178951..180099 | - | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
| M9P58_RS28970 (M9P58_28970) | 180270..181427 | - | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
| M9P58_RS28975 (M9P58_28975) | 181443..182117 | - | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
| M9P58_RS28980 (M9P58_28980) | 182122..182556 | - | 435 | WP_000103648.1 | RidA family protein | - |
| M9P58_RS28985 (M9P58_28985) | 182876..183106 | + | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9P58_RS28990 (M9P58_28990) | 183103..183519 | + | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
| M9P58_RS28995 (M9P58_28995) | 183842..184810 | + | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
| M9P58_RS29000 (M9P58_29000) | 184990..185364 | - | 375 | WP_032408891.1 | hypothetical protein | - |
| M9P58_RS29005 (M9P58_29005) | 185420..185746 | - | 327 | WP_004152639.1 | hypothetical protein | - |
| M9P58_RS29010 (M9P58_29010) | 185743..186471 | - | 729 | WP_014386162.1 | plasmid SOS inhibition protein A | - |
| M9P58_RS29015 (M9P58_29015) | 186468..186899 | - | 432 | WP_014386161.1 | conjugation system SOS inhibitor PsiB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / dfrA12 / aadA2 / qacE / sul1 / mph(A) | - | 1..205645 | 205645 | |
| - | flank | IS/Tn | - | - | 183842..184810 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T245698 WP_014386165.1 NZ_CP097628:183103-183519 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|