Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53667..54403 Replicon plasmid p1_140253
Accession NZ_CP097628
Organism Klebsiella pneumoniae strain 140253

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M9P58_RS28260 Protein ID WP_003026803.1
Coordinates 53921..54403 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M9P58_RS28255 Protein ID WP_003026799.1
Coordinates 53667..53933 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9P58_RS28210 (M9P58_28210) 49729..50091 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M9P58_RS28215 (M9P58_28215) 50141..50491 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M9P58_RS28220 (M9P58_28220) 50849..51118 + 270 WP_004152102.1 hypothetical protein -
M9P58_RS28225 (M9P58_28225) 51106..51681 + 576 WP_004152103.1 hypothetical protein -
M9P58_RS28230 (M9P58_28230) 51712..52206 + 495 WP_004152104.1 DNA-binding protein -
M9P58_RS28235 (M9P58_28235) 52250..52618 + 369 WP_004152105.1 hypothetical protein -
M9P58_RS28240 (M9P58_28240) 52652..52855 + 204 WP_004152106.1 HHA domain-containing protein -
M9P58_RS28245 (M9P58_28245) 52904..53161 + 258 WP_004152107.1 hypothetical protein -
M9P58_RS28250 (M9P58_28250) 53237..53491 + 255 WP_004152108.1 hypothetical protein -
M9P58_RS28255 (M9P58_28255) 53667..53933 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M9P58_RS28260 (M9P58_28260) 53921..54403 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M9P58_RS28265 (M9P58_28265) 54615..55961 + 1347 WP_020314316.1 ISNCY family transposase -
M9P58_RS29530 56122..56253 + 132 WP_004218042.1 hypothetical protein -
M9P58_RS28270 (M9P58_28270) 56462..57627 - 1166 Protein_59 IS3 family transposase -
M9P58_RS28275 (M9P58_28275) 57804..58766 - 963 WP_004152113.1 zinc metalloprotease HtpX -
M9P58_RS28280 (M9P58_28280) 58753..59241 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / dfrA12 / aadA2 / qacE / sul1 / mph(A) - 1..205645 205645


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T245696 WP_003026803.1 NZ_CP097628:53921-54403 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT245696 WP_003026799.1 NZ_CP097628:53667-53933 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References