Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 149293..149936 | Replicon | plasmid pKPC2_140253 |
| Accession | NZ_CP097627 | ||
| Organism | Klebsiella pneumoniae strain 140253 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | M9P58_RS27925 | Protein ID | WP_001044770.1 |
| Coordinates | 149293..149709 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | M9P58_RS27930 | Protein ID | WP_001261282.1 |
| Coordinates | 149706..149936 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9P58_RS27905 (145396) | 145396..145668 | - | 273 | Protein_189 | transposase | - |
| M9P58_RS27915 (146650) | 146650..147672 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| M9P58_RS27920 (147657) | 147657..149219 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| M9P58_RS27925 (149293) | 149293..149709 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9P58_RS27930 (149706) | 149706..149936 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9P58_RS27935 (149893) | 149893..150354 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| M9P58_RS27940 (150515) | 150515..151459 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| M9P58_RS27945 (151496) | 151496..151888 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| M9P58_RS27950 (151946) | 151946..152467 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| M9P58_RS27955 (152513) | 152513..152716 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| M9P58_RS27960 (152746) | 152746..153750 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| M9P58_RS27965 (153934) | 153934..154713 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155793 | 155793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T245695 WP_001044770.1 NZ_CP097627:c149709-149293 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |