Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4907467..4907983 | Replicon | chromosome |
Accession | NZ_CP097626 | ||
Organism | Klebsiella pneumoniae strain 140253 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | M9P58_RS24280 | Protein ID | WP_002886902.1 |
Coordinates | 4907467..4907751 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M9P58_RS24285 | Protein ID | WP_002886901.1 |
Coordinates | 4907741..4907983 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9P58_RS24255 (M9P58_24255) | 4902951..4903214 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
M9P58_RS24260 (M9P58_24260) | 4903344..4903517 | + | 174 | WP_002886906.1 | hypothetical protein | - |
M9P58_RS24265 (M9P58_24265) | 4903520..4904263 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M9P58_RS24270 (M9P58_24270) | 4904620..4906758 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M9P58_RS24275 (M9P58_24275) | 4906999..4907463 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M9P58_RS24280 (M9P58_24280) | 4907467..4907751 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9P58_RS24285 (M9P58_24285) | 4907741..4907983 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M9P58_RS24290 (M9P58_24290) | 4908061..4909971 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M9P58_RS24295 (M9P58_24295) | 4909994..4911148 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M9P58_RS24300 (M9P58_24300) | 4911214..4911954 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T245685 WP_002886902.1 NZ_CP097626:c4907751-4907467 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |