Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4191123..4191742 Replicon chromosome
Accession NZ_CP097626
Organism Klebsiella pneumoniae strain 140253

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M9P58_RS20845 Protein ID WP_002892050.1
Coordinates 4191524..4191742 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M9P58_RS20840 Protein ID WP_002892066.1
Coordinates 4191123..4191497 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9P58_RS20830 (M9P58_20830) 4186275..4187468 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M9P58_RS20835 (M9P58_20835) 4187491..4190637 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M9P58_RS20840 (M9P58_20840) 4191123..4191497 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M9P58_RS20845 (M9P58_20845) 4191524..4191742 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M9P58_RS20850 (M9P58_20850) 4191901..4192467 + 567 WP_002892030.1 maltose O-acetyltransferase -
M9P58_RS20855 (M9P58_20855) 4192439..4192579 - 141 WP_004147370.1 hypothetical protein -
M9P58_RS20860 (M9P58_20860) 4192600..4193070 + 471 WP_002892026.1 YlaC family protein -
M9P58_RS20865 (M9P58_20865) 4193045..4194496 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M9P58_RS20870 (M9P58_20870) 4194597..4195295 + 699 WP_002892021.1 GNAT family protein -
M9P58_RS20875 (M9P58_20875) 4195292..4195432 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M9P58_RS20880 (M9P58_20880) 4195432..4195695 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245683 WP_002892050.1 NZ_CP097626:4191524-4191742 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245683 WP_002892066.1 NZ_CP097626:4191123-4191497 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References