Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1181930..1182531 Replicon chromosome
Accession NZ_CP097618
Organism Pasteurella multocida strain P2095

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag M8854_RS05445 Protein ID WP_064965010.1
Coordinates 1182217..1182531 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M8854_RS05440 Protein ID WP_064965011.1
Coordinates 1181930..1182220 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8854_RS05400 (M8854_05400) 1177199..1177636 - 438 WP_064965060.1 DUF1367 family protein -
M8854_RS05405 (M8854_05405) 1177645..1178175 - 531 WP_064965018.1 MT-A70 family methyltransferase -
M8854_RS05410 (M8854_05410) 1178168..1178866 - 699 WP_064965017.1 replication protein P -
M8854_RS05415 (M8854_05415) 1178863..1179675 - 813 WP_064965016.1 replication protein -
M8854_RS05420 (M8854_05420) 1179672..1180355 - 684 WP_064965015.1 phage antirepressor KilAC domain-containing protein -
M8854_RS05425 (M8854_05425) 1180413..1180862 - 450 WP_064965014.1 YmfL family putative regulatory protein -
M8854_RS05430 (M8854_05430) 1180911..1181117 - 207 WP_064965013.1 helix-turn-helix transcriptional regulator -
M8854_RS05435 (M8854_05435) 1181255..1181887 + 633 WP_064965012.1 S24 family peptidase -
M8854_RS05440 (M8854_05440) 1181930..1182220 - 291 WP_064965011.1 putative addiction module antidote protein Antitoxin
M8854_RS05445 (M8854_05445) 1182217..1182531 - 315 WP_064965010.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M8854_RS05450 (M8854_05450) 1182791..1182967 + 177 WP_196767648.1 hypothetical protein -
M8854_RS05470 (M8854_05470) 1184633..1185274 + 642 WP_064965009.1 DUF3560 domain-containing protein -
M8854_RS05475 (M8854_05475) 1185319..1185600 + 282 WP_064965008.1 hypothetical protein -
M8854_RS05480 (M8854_05480) 1185587..1185814 + 228 WP_064965007.1 hypothetical protein -
M8854_RS05485 (M8854_05485) 1185827..1185988 + 162 WP_179121407.1 hypothetical protein -
M8854_RS05490 (M8854_05490) 1185991..1186947 + 957 WP_064965006.1 hypothetical protein -
M8854_RS05495 (M8854_05495) 1186958..1187494 + 537 Protein_1047 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1137536..1197769 60233


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(4-95)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11779.66 Da        Isoelectric Point: 9.7597

>T245667 WP_064965010.1 NZ_CP097618:c1182531-1182217 [Pasteurella multocida]
MFELIETTVFNKWLKELKDLSAKAAILARINRAKNGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEGVNV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10586.23 Da        Isoelectric Point: 5.1425

>AT245667 WP_064965011.1 NZ_CP097618:c1182220-1181930 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEVLETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSYGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References