Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1181930..1182531 | Replicon | chromosome |
| Accession | NZ_CP097618 | ||
| Organism | Pasteurella multocida strain P2095 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M8854_RS05445 | Protein ID | WP_064965010.1 |
| Coordinates | 1182217..1182531 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M8854_RS05440 | Protein ID | WP_064965011.1 |
| Coordinates | 1181930..1182220 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8854_RS05400 (M8854_05400) | 1177199..1177636 | - | 438 | WP_064965060.1 | DUF1367 family protein | - |
| M8854_RS05405 (M8854_05405) | 1177645..1178175 | - | 531 | WP_064965018.1 | MT-A70 family methyltransferase | - |
| M8854_RS05410 (M8854_05410) | 1178168..1178866 | - | 699 | WP_064965017.1 | replication protein P | - |
| M8854_RS05415 (M8854_05415) | 1178863..1179675 | - | 813 | WP_064965016.1 | replication protein | - |
| M8854_RS05420 (M8854_05420) | 1179672..1180355 | - | 684 | WP_064965015.1 | phage antirepressor KilAC domain-containing protein | - |
| M8854_RS05425 (M8854_05425) | 1180413..1180862 | - | 450 | WP_064965014.1 | YmfL family putative regulatory protein | - |
| M8854_RS05430 (M8854_05430) | 1180911..1181117 | - | 207 | WP_064965013.1 | helix-turn-helix transcriptional regulator | - |
| M8854_RS05435 (M8854_05435) | 1181255..1181887 | + | 633 | WP_064965012.1 | S24 family peptidase | - |
| M8854_RS05440 (M8854_05440) | 1181930..1182220 | - | 291 | WP_064965011.1 | putative addiction module antidote protein | Antitoxin |
| M8854_RS05445 (M8854_05445) | 1182217..1182531 | - | 315 | WP_064965010.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8854_RS05450 (M8854_05450) | 1182791..1182967 | + | 177 | WP_196767648.1 | hypothetical protein | - |
| M8854_RS05470 (M8854_05470) | 1184633..1185274 | + | 642 | WP_064965009.1 | DUF3560 domain-containing protein | - |
| M8854_RS05475 (M8854_05475) | 1185319..1185600 | + | 282 | WP_064965008.1 | hypothetical protein | - |
| M8854_RS05480 (M8854_05480) | 1185587..1185814 | + | 228 | WP_064965007.1 | hypothetical protein | - |
| M8854_RS05485 (M8854_05485) | 1185827..1185988 | + | 162 | WP_179121407.1 | hypothetical protein | - |
| M8854_RS05490 (M8854_05490) | 1185991..1186947 | + | 957 | WP_064965006.1 | hypothetical protein | - |
| M8854_RS05495 (M8854_05495) | 1186958..1187494 | + | 537 | Protein_1047 | phage recombination protein Bet | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1137536..1197769 | 60233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11779.66 Da Isoelectric Point: 9.7597
>T245667 WP_064965010.1 NZ_CP097618:c1182531-1182217 [Pasteurella multocida]
MFELIETTVFNKWLKELKDLSAKAAILARINRAKNGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEGVNV
MFELIETTVFNKWLKELKDLSAKAAILARINRAKNGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEGVNV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|