Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-PumB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2124139..2124740 | Replicon | chromosome |
Accession | NZ_CP097608 | ||
Organism | Pasteurella multocida strain 11205 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M8848_RS09945 | Protein ID | WP_250193613.1 |
Coordinates | 2124139..2124453 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | M8848_RS09950 | Protein ID | WP_223131908.1 |
Coordinates | 2124450..2124740 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8848_RS09910 (M8848_09910) | 2119683..2120678 | - | 996 | WP_250193609.1 | hypothetical protein | - |
M8848_RS09915 (M8848_09915) | 2120858..2121085 | - | 228 | WP_250193610.1 | hypothetical protein | - |
M8848_RS09920 (M8848_09920) | 2121072..2121362 | - | 291 | WP_250193611.1 | hypothetical protein | - |
M8848_RS09925 (M8848_09925) | 2121406..2122047 | - | 642 | WP_250193612.1 | DUF3560 domain-containing protein | - |
M8848_RS09940 (M8848_09940) | 2123725..2123877 | - | 153 | WP_250027738.1 | hypothetical protein | - |
M8848_RS09945 (M8848_09945) | 2124139..2124453 | + | 315 | WP_250193613.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8848_RS09950 (M8848_09950) | 2124450..2124740 | + | 291 | WP_223131908.1 | putative addiction module antidote protein | Antitoxin |
M8848_RS09955 (M8848_09955) | 2124785..2125417 | - | 633 | WP_250193614.1 | S24 family peptidase | - |
M8848_RS09960 (M8848_09960) | 2125556..2125762 | + | 207 | WP_250193615.1 | helix-turn-helix transcriptional regulator | - |
M8848_RS09965 (M8848_09965) | 2125810..2126262 | + | 453 | WP_250193616.1 | hypothetical protein | - |
M8848_RS09970 (M8848_09970) | 2126363..2127010 | + | 648 | WP_250193789.1 | phage antirepressor KilAC domain-containing protein | - |
M8848_RS09975 (M8848_09975) | 2127007..2127819 | + | 813 | WP_250193617.1 | replication protein | - |
M8848_RS09980 (M8848_09980) | 2127816..2128514 | + | 699 | WP_250193618.1 | replication protein P | - |
M8848_RS09985 (M8848_09985) | 2128507..2129037 | + | 531 | WP_250193619.1 | MT-A70 family methyltransferase | - |
M8848_RS09990 (M8848_09990) | 2129047..2129397 | + | 351 | WP_250193620.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2099289..2164177 | 64888 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11837.74 Da Isoelectric Point: 9.7597
>T245660 WP_250193613.1 NZ_CP097608:2124139-2124453 [Pasteurella multocida]
MFEIIETTVFNKWLKELKDLSAKAAILARINRAKNGNFGDHKSVGDGLYEMRIMKGAGYRVYYTQYKDVTYLLICGGDKS
TQKADIAKAKVLWEEIKQKEGVNV
MFEIIETTVFNKWLKELKDLSAKAAILARINRAKNGNFGDHKSVGDGLYEMRIMKGAGYRVYYTQYKDVTYLLICGGDKS
TQKADIAKAKVLWEEIKQKEGVNV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|