Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 449427..450001 | Replicon | chromosome |
Accession | NZ_CP097606 | ||
Organism | Pasteurella multocida strain 10957 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | M8846_RS02085 | Protein ID | WP_061406134.1 |
Coordinates | 449427..449711 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | M8846_RS02090 | Protein ID | WP_061406133.1 |
Coordinates | 449708..450001 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8846_RS02065 (M8846_02065) | 445220..446809 | - | 1590 | WP_250191770.1 | AAA family ATPase | - |
M8846_RS02070 (M8846_02070) | 447094..447585 | - | 492 | WP_284150420.1 | NERD domain-containing protein | - |
M8846_RS02075 (M8846_02075) | 447813..448148 | + | 336 | WP_223848039.1 | DUF3418 domain-containing protein | - |
M8846_RS02085 (M8846_02085) | 449427..449711 | + | 285 | WP_061406134.1 | hypothetical protein | Toxin |
M8846_RS02090 (M8846_02090) | 449708..450001 | + | 294 | WP_061406133.1 | putative addiction module antidote protein | Antitoxin |
M8846_RS02095 (M8846_02095) | 450403..451080 | - | 678 | WP_005751574.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
M8846_RS02100 (M8846_02100) | 451098..451565 | - | 468 | WP_005726755.1 | PTS sugar transporter subunit IIA | - |
M8846_RS02105 (M8846_02105) | 451610..453400 | - | 1791 | WP_005726754.1 | PTS ascorbate-specific subunit IIBC | - |
M8846_RS02110 (M8846_02110) | 453750..454841 | + | 1092 | WP_250191772.1 | L-ascorbate 6-phosphate lactonase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10667.40 Da Isoelectric Point: 10.2297
>T245656 WP_061406134.1 NZ_CP097606:449427-449711 [Pasteurella multocida]
VGRLKEVKILSAKSAVLARINKAMNGNFGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLKEVKILSAKSAVLARINKAMNGNFGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|