Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 594247..594848 | Replicon | chromosome |
Accession | NZ_CP097604 | ||
Organism | Pasteurella multocida strain 10159 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M8331_RS02730 | Protein ID | WP_083002329.1 |
Coordinates | 594247..594561 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M8331_RS02735 | Protein ID | WP_083002326.1 |
Coordinates | 594558..594848 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8331_RS02700 (M8331_02700) | 589704..590729 | - | 1026 | WP_083002339.1 | hypothetical protein | - |
M8331_RS02705 (M8331_02705) | 590814..591782 | - | 969 | WP_083002337.1 | reverse transcriptase family protein | - |
M8331_RS02710 (M8331_02710) | 591757..592068 | - | 312 | WP_083002334.1 | helix-turn-helix transcriptional regulator | - |
M8331_RS02715 (M8331_02715) | 593080..593307 | - | 228 | WP_083002331.1 | hypothetical protein | - |
M8331_RS02720 (M8331_02720) | 593549..593758 | - | 210 | WP_005756656.1 | hypothetical protein | - |
M8331_RS02725 (M8331_02725) | 593771..593938 | + | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
M8331_RS02730 (M8331_02730) | 594247..594561 | + | 315 | WP_083002329.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8331_RS02735 (M8331_02735) | 594558..594848 | + | 291 | WP_083002326.1 | putative addiction module antidote protein | Antitoxin |
M8331_RS02740 (M8331_02740) | 594874..595713 | - | 840 | WP_083002324.1 | DNA replication protein DnaD | - |
M8331_RS02745 (M8331_02745) | 595805..596491 | - | 687 | WP_083002321.1 | XRE family transcriptional regulator | - |
M8331_RS02750 (M8331_02750) | 596619..596828 | + | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
M8331_RS02755 (M8331_02755) | 596901..597329 | + | 429 | WP_250190967.1 | hypothetical protein | - |
M8331_RS02760 (M8331_02760) | 597332..597739 | - | 408 | WP_227718008.1 | hypothetical protein | - |
M8331_RS02765 (M8331_02765) | 597851..598081 | + | 231 | WP_083002312.1 | helix-turn-helix domain-containing protein | - |
M8331_RS02770 (M8331_02770) | 598174..599034 | + | 861 | WP_083002309.1 | DNA replication protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 581648..632590 | 50942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11690.61 Da Isoelectric Point: 9.9218
>T245653 WP_083002329.1 NZ_CP097604:594247-594561 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDITYLLICGGDKS
TQKANIAKAKALWEEIKQKEGVNV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDITYLLICGGDKS
TQKANIAKAKALWEEIKQKEGVNV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|