Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1741481..1742118 | Replicon | chromosome |
Accession | NZ_CP097602 | ||
Organism | Bacillus velezensis strain UA0244 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M8965_RS09030 | Protein ID | WP_003156187.1 |
Coordinates | 1741481..1741831 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M8965_RS09035 | Protein ID | WP_003156188.1 |
Coordinates | 1741837..1742118 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8965_RS08990 | 1736521..1737123 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
M8965_RS08995 | 1737123..1737911 | - | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
M8965_RS09000 | 1737877..1738359 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M8965_RS09005 | 1738356..1738685 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M8965_RS09010 | 1738749..1739756 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
M8965_RS09015 | 1739768..1740169 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M8965_RS09020 | 1740172..1740537 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M8965_RS09025 | 1740542..1741363 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M8965_RS09030 | 1741481..1741831 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M8965_RS09035 | 1741837..1742118 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M8965_RS09040 | 1742238..1743407 | - | 1170 | WP_032873001.1 | alanine racemase | - |
M8965_RS09045 | 1743524..1744531 | - | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
M8965_RS09050 | 1744696..1745061 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
M8965_RS09055 | 1745154..1745753 | + | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245651 WP_003156187.1 NZ_CP097602:c1741831-1741481 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|