Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3112258..3113175 | Replicon | chromosome |
Accession | NZ_CP097594 | ||
Organism | Bacillus velezensis strain UA0182 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | M8968_RS15090 | Protein ID | WP_007407256.1 |
Coordinates | 3112258..3113004 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8968_RS15095 | Protein ID | WP_003154807.1 |
Coordinates | 3113005..3113175 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8968_RS15070 | 3107651..3108601 | - | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
M8968_RS15075 | 3108923..3110239 | + | 1317 | WP_032874616.1 | amino acid permease | - |
M8968_RS15080 | 3110525..3111142 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
M8968_RS15085 | 3111155..3112153 | + | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
M8968_RS15090 | 3112258..3113004 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8968_RS15095 | 3113005..3113175 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8968_RS15100 | 3113272..3113397 | + | 126 | WP_003154809.1 | hypothetical protein | - |
M8968_RS15105 | 3113432..3114310 | - | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8968_RS15110 | 3114324..3114587 | - | 264 | WP_003154813.1 | phage holin | - |
M8968_RS15115 | 3114601..3114864 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8968_RS15120 | 3114916..3115677 | - | 762 | WP_032874607.1 | hypothetical protein | - |
M8968_RS15125 | 3115734..3115931 | - | 198 | WP_032874605.1 | XkdX family protein | - |
M8968_RS15130 | 3115936..3116307 | - | 372 | WP_032874603.1 | XkdW family protein | - |
M8968_RS15135 | 3116320..3117942 | - | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3103983..3156767 | 52784 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T245650 WP_007407256.1 NZ_CP097594:3112258-3113004 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|