Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2237516..2238433 | Replicon | chromosome |
Accession | NZ_CP097593 | ||
Organism | Bacillus velezensis strain UA0229 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | M8969_RS10585 | Protein ID | WP_007407256.1 |
Coordinates | 2237516..2238262 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8969_RS10590 | Protein ID | WP_003154807.1 |
Coordinates | 2238263..2238433 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8969_RS10565 | 2232909..2233859 | - | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
M8969_RS10570 | 2234181..2235497 | + | 1317 | WP_032874616.1 | amino acid permease | - |
M8969_RS10575 | 2235783..2236400 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
M8969_RS10580 | 2236413..2237411 | + | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
M8969_RS10585 | 2237516..2238262 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8969_RS10590 | 2238263..2238433 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8969_RS10595 | 2238530..2238655 | + | 126 | WP_003154809.1 | hypothetical protein | - |
M8969_RS10600 | 2238690..2239568 | - | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8969_RS10605 | 2239582..2239845 | - | 264 | WP_003154813.1 | phage holin | - |
M8969_RS10610 | 2239859..2240122 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8969_RS10615 | 2240174..2240935 | - | 762 | WP_032874607.1 | hypothetical protein | - |
M8969_RS10620 | 2240992..2241189 | - | 198 | WP_032874605.1 | XkdX family protein | - |
M8969_RS10625 | 2241194..2241565 | - | 372 | WP_032874603.1 | XkdW family protein | - |
M8969_RS10630 | 2241578..2243200 | - | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T245648 WP_007407256.1 NZ_CP097593:2237516-2238262 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|