Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 637541..638178 | Replicon | chromosome |
Accession | NZ_CP097593 | ||
Organism | Bacillus velezensis strain UA0229 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M8969_RS03080 | Protein ID | WP_003156187.1 |
Coordinates | 637828..638178 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M8969_RS03075 | Protein ID | WP_003156188.1 |
Coordinates | 637541..637822 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8969_RS03055 | 633906..634505 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
M8969_RS03060 | 634598..634963 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
M8969_RS03065 | 635128..636135 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
M8969_RS03070 | 636252..637421 | + | 1170 | WP_032873001.1 | alanine racemase | - |
M8969_RS03075 | 637541..637822 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M8969_RS03080 | 637828..638178 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M8969_RS03085 | 638296..639117 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M8969_RS03090 | 639122..639487 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M8969_RS03095 | 639490..639891 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M8969_RS03100 | 639903..640910 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
M8969_RS03105 | 640974..641303 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M8969_RS03110 | 641300..641782 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M8969_RS03115 | 641748..642536 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
M8969_RS03120 | 642536..643138 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245647 WP_003156187.1 NZ_CP097593:637828-638178 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|