Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3731540..3732177 | Replicon | chromosome |
Accession | NZ_CP097591 | ||
Organism | Bacillus velezensis strain UA0188 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M8962_RS18470 | Protein ID | WP_003156187.1 |
Coordinates | 3731827..3732177 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M8962_RS18465 | Protein ID | WP_003156188.1 |
Coordinates | 3731540..3731821 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8962_RS18445 | 3727905..3728504 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
M8962_RS18450 | 3728597..3728962 | + | 366 | WP_012116869.1 | holo-ACP synthase | - |
M8962_RS18455 | 3729127..3730134 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
M8962_RS18460 | 3730251..3731420 | + | 1170 | WP_012116870.1 | alanine racemase | - |
M8962_RS18465 | 3731540..3731821 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M8962_RS18470 | 3731827..3732177 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M8962_RS18475 | 3732295..3733116 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M8962_RS18480 | 3733121..3733486 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M8962_RS18485 | 3733489..3733890 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M8962_RS18490 | 3733902..3734909 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
M8962_RS18495 | 3734973..3735302 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M8962_RS18500 | 3735299..3735781 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M8962_RS18505 | 3735747..3736535 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M8962_RS18510 | 3736535..3737137 | + | 603 | WP_012116871.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245646 WP_003156187.1 NZ_CP097591:3731827-3732177 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|