Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 229763..230680 | Replicon | chromosome |
| Accession | NZ_CP097591 | ||
| Organism | Bacillus velezensis strain UA0188 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | - |
| Locus tag | M8962_RS01110 | Protein ID | WP_012117368.1 |
| Coordinates | 229934..230680 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | M8962_RS01105 | Protein ID | WP_003154807.1 |
| Coordinates | 229763..229933 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8962_RS01055 | 224897..225409 | + | 513 | WP_012117362.1 | sigma-70 family RNA polymerase sigma factor | - |
| M8962_RS01060 | 225522..225755 | + | 234 | WP_012117363.1 | XtmA | - |
| M8962_RS01065 | 225771..226619 | + | 849 | WP_012117364.1 | hypothetical protein | - |
| M8962_RS01070 | 226632..227003 | + | 372 | WP_012117365.1 | XkdW family protein | - |
| M8962_RS01075 | 227008..227205 | + | 198 | WP_012117366.1 | XkdX family protein | - |
| M8962_RS01080 | 227262..228023 | + | 762 | WP_012117367.1 | hypothetical protein | - |
| M8962_RS01085 | 228075..228338 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| M8962_RS01090 | 228352..228615 | + | 264 | WP_003154813.1 | phage holin | - |
| M8962_RS01095 | 228629..229507 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M8962_RS01105 | 229763..229933 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| M8962_RS01110 | 229934..230680 | - | 747 | WP_012117368.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| M8962_RS01115 | 230785..231783 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
| M8962_RS01120 | 231796..232413 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| M8962_RS01125 | 232699..234015 | - | 1317 | WP_007610842.1 | amino acid permease | - |
| M8962_RS01130 | 234338..235288 | + | 951 | WP_012117369.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29119.61 Da Isoelectric Point: 4.7003
>T245645 WP_012117368.1 NZ_CP097591:c230680-229934 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQADKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQADKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|