Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 379783..380700 | Replicon | chromosome |
Accession | NZ_CP097590 | ||
Organism | Bacillus velezensis strain UA0195 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | M8970_RS02120 | Protein ID | WP_007407256.1 |
Coordinates | 379954..380700 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8970_RS02115 | Protein ID | WP_003154807.1 |
Coordinates | 379783..379953 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8970_RS02075 | 375016..376638 | + | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
M8970_RS02080 | 376651..377022 | + | 372 | WP_032874603.1 | XkdW family protein | - |
M8970_RS02085 | 377027..377224 | + | 198 | WP_032874605.1 | XkdX family protein | - |
M8970_RS02090 | 377281..378042 | + | 762 | WP_032874607.1 | hypothetical protein | - |
M8970_RS02095 | 378094..378357 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8970_RS02100 | 378371..378634 | + | 264 | WP_003154813.1 | phage holin | - |
M8970_RS02105 | 378648..379526 | + | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8970_RS02110 | 379561..379686 | - | 126 | WP_003154809.1 | hypothetical protein | - |
M8970_RS02115 | 379783..379953 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8970_RS02120 | 379954..380700 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8970_RS02125 | 380805..381803 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
M8970_RS02130 | 381816..382433 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
M8970_RS02135 | 382719..384035 | - | 1317 | WP_032874616.1 | amino acid permease | - |
M8970_RS02140 | 384357..385307 | + | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T245643 WP_007407256.1 NZ_CP097590:c380700-379954 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|