Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2115296..2115933 | Replicon | chromosome |
Accession | NZ_CP097589 | ||
Organism | Bacillus velezensis strain UA0311 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M8966_RS09965 | Protein ID | WP_003156187.1 |
Coordinates | 2115583..2115933 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M8966_RS09960 | Protein ID | WP_003156188.1 |
Coordinates | 2115296..2115577 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8966_RS09940 | 2111661..2112260 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
M8966_RS09945 | 2112353..2112718 | + | 366 | WP_012116869.1 | holo-ACP synthase | - |
M8966_RS09950 | 2112883..2113890 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
M8966_RS09955 | 2114007..2115176 | + | 1170 | WP_012116870.1 | alanine racemase | - |
M8966_RS09960 | 2115296..2115577 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M8966_RS09965 | 2115583..2115933 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M8966_RS09970 | 2116051..2116872 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M8966_RS09975 | 2116877..2117242 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M8966_RS09980 | 2117245..2117646 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M8966_RS09985 | 2117658..2118665 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
M8966_RS09990 | 2118729..2119058 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M8966_RS09995 | 2119055..2119537 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M8966_RS10000 | 2119503..2120291 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M8966_RS10005 | 2120291..2120893 | + | 603 | WP_012116871.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245642 WP_003156187.1 NZ_CP097589:2115583-2115933 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|