Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1422463..1423380 | Replicon | chromosome |
Accession | NZ_CP097589 | ||
Organism | Bacillus velezensis strain UA0311 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | M8966_RS06545 | Protein ID | WP_012117368.1 |
Coordinates | 1422463..1423209 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8966_RS06550 | Protein ID | WP_003154807.1 |
Coordinates | 1423210..1423380 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8966_RS06525 | 1417855..1418805 | - | 951 | WP_012117369.1 | ring-cleaving dioxygenase | - |
M8966_RS06530 | 1419128..1420444 | + | 1317 | WP_007610842.1 | amino acid permease | - |
M8966_RS06535 | 1420730..1421347 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
M8966_RS06540 | 1421360..1422358 | + | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
M8966_RS06545 | 1422463..1423209 | + | 747 | WP_012117368.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8966_RS06550 | 1423210..1423380 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8966_RS06560 | 1423636..1424514 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8966_RS06565 | 1424528..1424791 | - | 264 | WP_003154813.1 | phage holin | - |
M8966_RS06570 | 1424805..1425068 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8966_RS06575 | 1425120..1425881 | - | 762 | WP_012117367.1 | hypothetical protein | - |
M8966_RS06580 | 1425938..1426135 | - | 198 | WP_012117366.1 | XkdX family protein | - |
M8966_RS06585 | 1426140..1426511 | - | 372 | WP_012117365.1 | XkdW family protein | - |
M8966_RS06590 | 1426524..1427372 | - | 849 | WP_012117364.1 | hypothetical protein | - |
M8966_RS06595 | 1427388..1427621 | - | 234 | WP_012117363.1 | XtmA | - |
M8966_RS06600 | 1427734..1428246 | - | 513 | WP_012117362.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1414327..1437312 | 22985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29119.61 Da Isoelectric Point: 4.7003
>T245641 WP_012117368.1 NZ_CP097589:1422463-1423209 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQADKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQADKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|